Daniel A Zimmerman

US Patent:

6572860, Jun 3, 2003

Filed:

Mar 30, 2000

Appl. No.:

09/509593

Inventors:

Daniel H. Zimmerman - Bethesda MD
Kenneth S. Rosenthal - Akron OH

Assignee:

CEL-SCI Corporation - Vienna VA

International Classification:

A61K 39385

US Classification:

4241941, 4241851, 4241921, 4241931, 42419611, 4242021, 4242041, 4242311, 530403

Abstract:

Peptide constructs chemically synthesized to contain a Herpes Simplex Virus specific antigenic peptide, such as, the 322-332 peptide (H1) from the ICP27 protein of Herpes Simplex Virus (HSV-1) and a peptide from a T cell binding ligand (TCBL), such as -2M (aa 35-50), which elicits a TH1-like response in vitro tests in mice, were protective against challenge with HSV.

US Patent:

6951647, Oct 4, 2005

Filed:

May 24, 2001

Appl. No.:

10/296317

Inventors:

Daniel H. Zimmerman - Bethesda MD, US

Assignee:

Cel-Sci Corporation - Vienna VA

International Classification:

A61K039/00

US Classification:

4241921, 4241851, 4241931, 42419611, 4242781, 530324, 530326, 530350, 530403

Abstract:

The present invention is based, in part, on the discovery that a modified version of Peptide G (Asn Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile—SEQ ID NO:2) obtained by replacing Asn with Asp to form Peptide G′ (Asp Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile—SEQ ID NO: 1) overcomes the long range stabilization problem of the peptide conjugates and, quite surprisingly, also enhances the immune response, particularly the CD4 related (cell mediated) response, of conjugated peptides (L. E. A. P. S. constructs) as previously described.

US Patent:

6995237, Feb 7, 2006

Filed:

Oct 27, 2000

Appl. No.:

10/111645

Inventors:

Daniel H. Zimmerman - Bethesda MD, US

Assignee:

Cel-Sci Corporation - Vienna VA

International Classification:

A61K 39/00
C07K 14/435

US Classification:

530324, 514 12, 4241941, 4241851

Abstract:

Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.

US Patent:

7256254, Aug 14, 2007

Filed:

Dec 12, 2005

Appl. No.:

11/298718

Inventors:

Daniel Zimmerman - Bethesda MD, US

Assignee:

CEL-SCI Corporation - Vienna VA

International Classification:

C07K 9/00
C07K 14/00
A61K 39/00

US Classification:

530300, 530324, 530325, 530326, 530327, 530328, 4241851, 424810

Abstract:

Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.

US Patent:

20060134126, Jun 22, 2006

Filed:

Jan 23, 2003

Appl. No.:

10/502331

Inventors:

Daniel Zimmerman - Bethesda MD, US

International Classification:

A61K 39/00

US Classification:

424185100, 514002000

Abstract:

This invention relates to peptides directing a CD4 related T helper cell response wherein the peptides may be used as an adjuvant provided with an antigen or as an immunomodulatory agent without an antigen and compositions comprising modification of a fifteen-mer peptide sequence from the MHC IIβ chain at positions 135-149 known as Peptide G or a derivative of derG or other derivatives wherein the derivatives enhance the immune response of antigens compositions useful as a pharmaceutical, adjuvant, immunostimulant or immunomodulator to activate the immune system wherein the compositions may also be peptides, non-peptide mimetics or organic molecules selected from aliphatics, carbohydrates, heterocyclics, aromatics or mixtures thereof.

US Patent:

20060257420, Nov 16, 2006

Filed:

May 31, 2006

Appl. No.:

11/443314

Inventors:

Daniel Zimmerman - Bethesda MD, US

Assignee:

CEL-SCI Corporation - Vienna VA

International Classification:

A61K 39/00
C07K 14/47

US Classification:

424185100, 530324000

Abstract:

The invention is related to peptide constructs, i.e., polypeptides obtained by linking together two or more peptides based on or derived from different molecules, which are useful in the treatment or prevention of autoimmune diseases, asthma, allergies, and host versus graft (or graft versus host) rejection, as well as to compositions containing same, methods for producing same and methods for using same; wherein the peptide constructs have the formula P-x-Pwhere

US Patent:

20070003542, Jan 4, 2007

Filed:

Jan 23, 2003

Appl. No.:

10/502328

Inventors:

Daniel Zimmerman - Bethesda MD, US
Yupin Charoenvit - Silver Spring MD, US
Kenneth Rosenthal - Akron OH, US

International Classification:

A61K 39/395
A61K 39/00

US Classification:

424131100, 424185100

Abstract:

This invention relates to peptides directing a CD4 related T helper cell response wherein the peptides may be used as an adjuvant provided with an antigen or as an immunomodulatory agent without an antigen and compositions comprising modification of a fifteen-mer peptide sequence from the MHC IIβ chain at positions 135-149 known as Peptide G or a derivative of derG or other derivatives wherein the derivatives enhance the immune response of antigens and methods for treating cancer, autoimmune disease, transplant conditions, infectious conditions or allergies caused by foreign eukaryotic organisms, and infectious conditions or allergies caused by prokaryotic organisms or nonliving agents such as viruses, phages and prions with polypeptides.

US Patent:

20110098444, Apr 28, 2011

Filed:

Mar 16, 2009

Appl. No.:

12/922687

Inventors:

Daniel H. Zimmerman - Bethesda MD, US

Assignee:

CEL-SCI CORPORATION - Vienna VA

International Classification:

C07K 19/00
C07K 7/08

US Classification:

530324, 530300, 530326

Abstract:

The invention is related to peptide constructs, i.e., polypeptides obtained by linking together two or more peptides based on or derived from different molecules, which are useful in the treatment or prevention of autoimmune diseases, specifically rheumatoid arthritis (RA) and compositions containing same, methods for producing same and methods for using same; wherein the peptide constructs have the formula P-x-Pwhere Pis a peptide associated with autoimmune disease, allergy, asthma, host-versus-graft rejection, myocarditis, diabetes, and immune-mediated disease, which binds to an antigen receptor on a set or subset of T cells; Pis a peptide which will cause a T2 directed immune response by the set or subset of T cells to which the peptide Pis attached or which will bind to a T cell receptor which will cause the set or subset of T cells to which the peptide Pis attached to initiate, but not complete, an immune response causing the set or subset of T cells to undergo anergy and apoptosis; and x is a direct bond or linker for covalently bonding Pand P.