Robert D Fine

US Patent:

7772367, Aug 10, 2010

Filed:

Jan 27, 2005

Appl. No.:

10/587606

Inventors:

Robert L. Fine - Tenafly NJ, US
Paul Brandt-Rauf - Scarsdale NY, US
Yueha Mao - New York NY, US

Assignee:

The Trustees of Columbia University in the City of New York - New York NY

International Classification:

C07K 5/00
C07K 14/00
A61K 39/295

US Classification:

530350, 4241841

Abstract:

Disclosed are polypeptides comprising a first segment of continuous amino acids having the sequence AQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (SEQ ID NO. 1) covalently linked to a second segment of continuous amino acids having the sequence DSDPGETKFMLKKHRSTSQGKKSKLHSSHARSGGPEKGAQA (SEQ ID NO. 2), or at least two of each covalently linked to each ether. The polypeptides are shown to induce apoptosis of cancer cells that contain mutant p53 or over-expressed wild-type p53.

US Patent:

20070050257, Mar 1, 2007

Filed:

Jun 8, 2006

Appl. No.:

11/423107

Inventors:

Robert Fine - Harriman NY, US
Bruce Bolger - Hastings on Hudson NY, US
James Kilmetis - Commack NY, US

Assignee:

SELLING COMMUNICATIONS, INC. - Irvington NY

International Classification:

G06Q 30/00

US Classification:

705014000

Abstract:

The present invention is an online publishing management system and method that includes at least one advertisement computer means for storing an advertisement file; at least one article computer means for storing an article file; and a publishing management server computer. The publishing management server computer includes user interface means for receiving data from and sending data to user, database means for storing a plurality of database tables, and processing means. The database tables include an advertisement table having a plurality of advertisement records, each advertisement record having information regarding an advertisement file stored on an advertisement computer means; an advertiser table having a plurality of advertiser records, each advertiser record having information regarding an advertiser associated with at least one advertisement file stored on an advertisement computer means; and an article table having a plurality of article records, each article record having information regarding an article file stored on an article computer means. The processing means is adapted to generate a plurality of reports as a function of one or more of the database tables; allow a user to input, via the user interface means, criteria for generating the reports; provide the reports to a user via the user interface means; and allow a user to enter or modify, via the user interface means, records in any of the database tables.