Search

Robert A Fine

age ~81

from Sarasota, FL

Also known as:
  • Roberta Fine
Phone and address:
6611 41St Street Cir E, Sarasota, FL 34243

Robert Fine Phones & Addresses

  • 6611 41St Street Cir E, Sarasota, FL 34243
  • Cherry Hill, NJ
  • Plainsboro, NJ
  • 27 Saint Moritz Ln, Cherry Hill, NJ 08003

Medicine Doctors

Robert Fine Photo 1

Dr. Robert L Fine, New York NY - MD (Doctor of Medicine)

view source
Specialties:
Oncology
Medical Oncology
Address:
161 Fort Washington Ave Suite 6-435, New York, NY 10032
(212)3051168 (Phone), (212)3057348 (Fax)

650 W 168Th St Suite 2004, New York, NY 10032
(212)3051168 (Phone), (212)3057348 (Fax)

NEW YORK PRESBYTERIAN MEDICAL CENTER
650 W 168Th St Suite 20-04, New York, NY 10032
(212)3051168 (Phone), (212)3057348 (Fax)

COLUMBIA PRESBY MED
161 Fort Washington Ave, New York, NY 10032
(212)3051731 (Phone), (212)3056762 (Fax)
Certifications:
Internal Medicine, 1983
Medical Oncology, 1985
Awards:
Healthgrades Honor Roll
Languages:
English
Education:
Medical School
U Of Chgo Div Of Bio Sci Pritzker Sch Of Med
Graduated: 1979
Medical School
Clinical Center At The Nih
Graduated: 1979
Medical School
Stanford University Hospital
Graduated: 1979
Robert Fine Photo 2

Dr. Robert Fine, Altoona PA - MD (Doctor of Medicine)

view source
Specialties:
Emergency Medicine
Address:
620 Howard Ave, Altoona, PA 16601
(814)8893089 (Phone), (814)8896785 (Fax)

HONESDALE ANESTHESIA
601 Park St, Honesdale, PA 18431
(570)6989966 (Phone), (570)3429802 (Fax)

750 Brunswick Ave, Trenton, NJ 08638
(609)3946000 (Phone), (973)7409895 (Fax)

100 Medical Blvd, Canonsburg, PA 15317
(724)7453077 (Phone)
Certifications:
Emergency Medicine, 2006
Awards:
Healthgrades Honor Roll
Languages:
English
Education:
Medical School
Thomas Jefferson University
Graduated: 1977
Robert Fine Photo 3

Robert L. Fine

view source
Specialties:
Hematology/Oncology
Work:
New York Presbyterian Hospital Hematology Oncology Clinic
177 Ft Washington Ave, New York, NY 10032
(212)3058610 (phone), (212)3053035 (fax)

Columbia University Medical Center Hematology/oncology
161 Ft Washington Ave Herbert Irving Pav Hip, New York, NY 10032
(212)3055098 (phone), (212)3056762 (fax)
Education:
Medical School
University of Chicago Pritzker School of Medicine
Graduated: 1979
Procedures:
Chemotherapy
Conditions:
Liver Cancer
Lung Cancer
Pancreatic Cancer
Acute Bronchitis
Acute Renal Failure
Languages:
English
Spanish
Description:
Dr. Fine graduated from the University of Chicago Pritzker School of Medicine in 1979. He works in New York, NY and 1 other location and specializes in Hematology/Oncology. Dr. Fine is affiliated with New York Presbyterian Hospital Columbia University Medical Center and New York Presbyterian Westchester Division.
Robert Fine Photo 4

Robert L. Fine

view source
Specialties:
Hospice & Palliative Medicine
Work:
HealthTexas Provider NetworkSupportive & Palliative Care Clinic At Baylor University Medical Center At Dallas
3600 Gaston Ave STE 605, Dallas, TX 75246
(214)8209248 (phone), (214)8209258 (fax)
Education:
Medical School
University of Texas Southwestern Medical Center at Dallas
Graduated: 1978
Procedures:
Electrocardiogram (EKG or ECG)
Vaccine Administration
Conditions:
Abdominal Hernia
Acute Bronchitis
Acute Pancreatitis
Acute Pharyngitis
Acute Renal Failure
Languages:
English
Description:
Dr. Fine graduated from the University of Texas Southwestern Medical Center at Dallas in 1978. He works in Dallas, TX and specializes in Hospice & Palliative Medicine. Dr. Fine is affiliated with Baylor Scott & White Medical Center Waxahachie and Baylor University Medical Center.
Robert Fine Photo 5

Robert M. Fine

view source
Specialties:
Podiatric Medicine
Work:
Robert M Fine DPM
9 Clark St STE 3, Hudson Falls, NY 12839
(518)7472372 (phone), (518)7472543 (fax)
Languages:
English
Description:
Dr. Fine works in Hudson Falls, NY and specializes in Podiatric Medicine. Dr. Fine is affiliated with Glens Falls Hospital.
Robert Fine Photo 6

Robert Merrill Fine

view source
Specialties:
Colon & Rectal Surgery
Dermatology
Dermatopathology
Allergy
Education:
Tulane University (1955)
Robert Fine Photo 7

Robert Melvin Fine

view source
Specialties:
Emergency Medicine
Internal Medicine
Education:
Thomas Jefferson University (1977)
Robert Fine Photo 8

Robert Fine, Dallas TX

Work:
Medprovider Inpatient Care Unt
3434 Swiss Ave, Dallas, TX 75204
Herbert Irving Pavilion
161 Fort Washington Ave, New York, NY 10032

Real Estate Brokers

Robert Fine Photo 9

Robert Fine, Staten Island NY Licensed Real Estate Salesperson

view source
Specialties:
Buyer's Agent
Listing Agent
Foreclosure
Short-Sale
Work:
Coldwell Banker Di Tommaso Realty,
113 New Dorp Plaza N, Staten Island, NY 10306
(718)6678000 (Office), (646)8727700 (Cell), (718)6678272 (Fax)
Experience:
8 years
Description:
I am a full time professional Realtor, associated with Coldwell Banker Di Tommaso Realty of Staten Island, NY; licensed by the State of New York as a Real Estate Salesperson I am a Realtor member of the National Association of Realtors with a number of designations: CNE: Certified Negotiation Expert, e-Pro, GREEN, SFR: Short Sale and Foreclosure, and At Home with Diversity designation. Coldwell Banker Di Tommaso Realty has been an active force in the Staten Island real estate industry for many years. We are located on New Dorp Plaza in the heart of New Dorp. To demonstrate our faith in the future of Staten Island we have built a brand new 4000 square foot office, with the latest technology. Please call me or just drop by to visit. I am using my many years of leading edge technical expertise, gained while working in the Financial Industry, in my current real estate practice representing both Buyers and Sellers. I utilize a Text Message system for my Sellers, and also automated Feedback systems and appointment scheduling. Now is Great Time to Purchase or Sell a Home. The choices are excellent and the interest rate is historically low. Its time to make that first purchase of a home, or to trade up from your present house. Call 718-667-8000 and ask for Bob Fine. Call me directly at my cell at 646-872-7700. My web address is //statenisland.listingbook.com And My direct e-mail is [email protected]
Links:
Site
Facebook
Twitter
Robert Fine Photo 10

Robert Fine, Staten Island NY Agent

view source
Specialties:
REO / Bank Owned
Short sales
Residential sales
Luxury homes
First time home buyers
Distressed properties
Work:
Coldwell Banker Di Tommaso Realty.
Staten Island, NY
(718)6778000 (Phone)
License #647596534
Certifications:
SRES
GRI
SFR
e-PRO
Client type:
Home Buyers
Home Sellers
Property type:
Single Family Home
Condo/Townhome
Multi-family
Interests:
Helping my clients and customers achieve their Real Estate goals in an efficient manner.
About:
I am a Staten Island, NY full time REALTOR. I specialize in helping Buyers and Sellers fulfill their dreams and accomplish their goals in an efficient manner. I am associated with an real estate firm that is celebrating its 25th anniversary being a major Coldwell Banker office. Our technology is leading edge, while our values of hard work for our clients remain old fashioned. Call me and lets make an appointment to discuss your needs and wants for Selling and Buying. Please come on over to our new office building at 113 New Dorp Plaza. My office number is 718-667-8000 x 119. Call my cell directly at 646-872-7700. email to: [email protected]

Resumes

Robert Fine Photo 11

Vp Finance & Strategic Planning

view source
Position:
VP Finance & Strategic Planning at MasterCard
Location:
Greater New York City Area
Industry:
Banking
Work:
MasterCard since Jun 2006
VP Finance & Strategic Planning

MasterCard Jul 2004 - Jun 2006
Director, Corporate Planning and Financial Analysis

Interpublic Group Jun 2002 - Jun 2004
Interpublic Sports & Entertainment Group Controller

Cappelli Enterprises Jun 2000 - Apr 2002
Controller/Financial Analyst

Ernst & Young Apr 1999 - Jun 2000
Senior Associate
Education:
Northeastern University 1995 - 1996
MS Accounting/MBA, Accounting/Finance
University of Rochester 1988 - 1992
Robert Fine Photo 12

Outside Sales For Southeastern Co, Eastern Nm, & Western Ks At Rust Automation & Controls, Inc.

view source
Location:
United States
Industry:
Industrial Automation
Robert Fine Photo 13

Hands-On Accomplished Real Estate Practioner

view source
Position:
NYS Licensed Sales Person at Coldwell Banker DiTomasso, Home Retention Consultant at Titanium Solutions (Self-employed), Independent Broker Price Opinion Contractor at Self Employed
Location:
Greater New York City Area
Industry:
Real Estate
Work:
Coldwell Banker DiTomasso since May 2010
NYS Licensed Sales Person

Titanium Solutions since Jul 2009
Home Retention Consultant

Self Employed since Jun 2009
Independent Broker Price Opinion Contractor

VIP Real Estate. Jan 2007 - May 2010
Licensed Real Estate Salesperson

Euronext 2001 - 2009
Consultant
Education:
City University of New York-Brooklyn College 1961 - 1965
Skills:
Investment Properties
Short Sales
Foreclosures
Real Estate Transactions
Real Estate
Robert Fine Photo 14

Radiation Oncologist At Mt Sinai Medical Center In Miami Beach, Fl

view source
Position:
Radiation Oncologist at University Hospitals of Cleveland
Location:
Delray Beach, Florida
Industry:
Health, Wellness and Fitness
Work:
University Hospitals of Cleveland since 2009
Radiation Oncologist
Education:
The George Washington University School of Medicine and Health Sciences 1966 - 1970
MD, Medicine
Robert Fine Photo 15

Svp & Group Director At Signature Bank

view source
Position:
SVP & Group Director at Signature Bank
Location:
Greater New York City Area
Industry:
Banking
Work:
Signature Bank
SVP & Group Director

BLT Leasing Corp 1983 - 1995
President
Robert Fine Photo 16

Consultant At Fine Family Dental

view source
Position:
Consultant at Fine Family Dental
Location:
Greater New York City Area
Industry:
Food & Beverages
Work:
Fine Family Dental - Englewood New Jersey since Oct 2012
Consultant

Dana Imports Jan 2008 - Oct 2009
Consultant

Passaic Board of Education Mar 2005 - Jan 2008
Teacher

The B. Manischewitz Company - Jersey City NJ Mar 1983 - Jun 2004
Director of Materials Management
Education:
Rutgers, The State University of New Jersey-Newark 1972 - 1976
MBA, Management
Rutgers, The State University of New Jersey-Newark 1968 - 1972
BA, Economics
Robert Fine Photo 17

Commercial Banking Professional

view source
Location:
Greater New York City Area
Industry:
Banking
Robert Fine Photo 18

Robert Fine

view source
Location:
Greater New York City Area
Industry:
Computer Networking
Name / Title
Company / Classification
Phones & Addresses
Robert Fine
Director
Lightdale, Charles M.D
Medical Doctor's Office
630 W 168 St, New York, NY 10032
Robert E. Fine
Principal, Religious Leader
Torah, Bet Synagogue
Religious Organization Synagogue
60 Smith Ave, Mount Kisco, NY 10549
(914)6667595
Robert L. Fine
Hematology
The New York and Presbyterian Hospital
Medical Doctor's Office · General Hospital · Health/Allied Services
161 Ft Washington Ave, New York, NY 10032
(212)3051020, (212)3055166, (212)3051860
Robert Fine
Chief Executive Offi, President
Ox Bodies, Inc
Robert Fine
Executive Managing Director And President Broadpoint Descap
Broadpoint Capital Inc.
1 Penn Plz FL 42, New York, NY 10119
(212)2737100
Robert Fine
Religious Leader
Temple Beth Israel
Religious Organization · Synagogues
1 Temple Dr, Port Washington, NY 11050
(516)7671708, (516)9446461
Robert Fine
Not The Information Technology Director-nothing To Do With Information Technology
MASTERCARD INCORPORATED
Credit Card Service
Mastercard Int'l, Purchase, NY 10577
2000 Purchase St, Purchase, NY 10577
(914)2492000
Robert Lance Fine
Medical Doctor
Robert Grant MD
Medical Doctor's Office · Surgeons · Cosmetic Surgery · Plastic Surgery
161 Ft Washington Ave, New York, NY 10032
(212)3053103

License Records

Robert Fine

License #:
MT002180T - Expired
Category:
Medicine
Type:
Graduate Medical Trainee

Robert H Fine

License #:
NS091947A - Expired
Category:
Real Estate Commission
Type:
Real Estate Salesperson-Standard

Isbn (Books And Publications)

Red Heat

view source

Author
Robert Fine

ISBN #
0380755653

American Literature: A Critical Survey

view source

Author
Robert Fine

ISBN #
0442277512

Being Stalked: A Memoir

view source

Author
Robert Fine

ISBN #
0701166851

Civil Society: Democratic Perspectives

view source

Author
Robert Fine

ISBN #
0714643130

Civil Society: Democratic Perspectives

view source

Author
Robert Fine

ISBN #
0714647624

Beyond Apartheid: Labour and Liberation in South Africa

view source

Author
Robert Fine

ISBN #
0745300456

Prostate Cancer: A Doctor's Personal Triumph

view source

Author
Robert Fine

ISBN #
0839768087

Social Theory after the Holocaust

view source

Author
Robert Fine

ISBN #
0853239657

Lawyers & Attorneys

Robert Fine Photo 19

Robert Fine - Lawyer

view source
Specialties:
Real Estate
ISLN:
907432379
Admitted:
1974
University:
University of Minnesota, B.A., 1970
Law School:
Washington University, J.D., 1973
Robert Fine Photo 20

Robert Fine - Lawyer

view source
Specialties:
Real Estate Law
ISLN:
907432409
Admitted:
1977
University:
University of Michigan, B.A., 1970; University of Michigan, M.A., 1974
Law School:
University of Michigan, J.D., 1977
Robert Fine Photo 21

Robert B. Fine - Lawyer

view source
Specialties:
Real Estate
ISLN:
907432379
Admitted:
1974
University:
University of Minnesota, B.A.
Law School:
Washington University, J.D.

Wikipedia References

Robert Fine Photo 22

Robert Fine

Work:
Position:

Judge • Sociologist

Education:
Academic degree:

Academics of the University of Warwick • Professor

Area of science:

Social theory

Skills & Activities:
Preference:

Stalking

Master status:

Student

Us Patents

  • C-Terminal P53 Palindromic Peptide That Induces Apoptosis Of Cells With Aberrant P53 And Uses Thereof

    view source
  • US Patent:
    7772367, Aug 10, 2010
  • Filed:
    Jan 27, 2005
  • Appl. No.:
    10/587606
  • Inventors:
    Robert L. Fine - Tenafly NJ, US
    Paul Brandt-Rauf - Scarsdale NY, US
    Yueha Mao - New York NY, US
  • Assignee:
    The Trustees of Columbia University in the City of New York - New York NY
  • International Classification:
    C07K 5/00
    C07K 14/00
    A61K 39/295
  • US Classification:
    530350, 4241841
  • Abstract:
    Disclosed are polypeptides comprising a first segment of continuous amino acids having the sequence AQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (SEQ ID NO. 1) covalently linked to a second segment of continuous amino acids having the sequence DSDPGETKFMLKKHRSTSQGKKSKLHSSHARSGGPEKGAQA (SEQ ID NO. 2), or at least two of each covalently linked to each ether. The polypeptides are shown to induce apoptosis of cancer cells that contain mutant p53 or over-expressed wild-type p53.
  • Online Publishing And Management System And Method

    view source
  • US Patent:
    20070050257, Mar 1, 2007
  • Filed:
    Jun 8, 2006
  • Appl. No.:
    11/423107
  • Inventors:
    Robert Fine - Harriman NY, US
    Bruce Bolger - Hastings on Hudson NY, US
    James Kilmetis - Commack NY, US
  • Assignee:
    SELLING COMMUNICATIONS, INC. - Irvington NY
  • International Classification:
    G06Q 30/00
  • US Classification:
    705014000
  • Abstract:
    The present invention is an online publishing management system and method that includes at least one advertisement computer means for storing an advertisement file; at least one article computer means for storing an article file; and a publishing management server computer. The publishing management server computer includes user interface means for receiving data from and sending data to user, database means for storing a plurality of database tables, and processing means. The database tables include an advertisement table having a plurality of advertisement records, each advertisement record having information regarding an advertisement file stored on an advertisement computer means; an advertiser table having a plurality of advertiser records, each advertiser record having information regarding an advertiser associated with at least one advertisement file stored on an advertisement computer means; and an article table having a plurality of article records, each article record having information regarding an article file stored on an article computer means. The processing means is adapted to generate a plurality of reports as a function of one or more of the database tables; allow a user to input, via the user interface means, criteria for generating the reports; provide the reports to a user via the user interface means; and allow a user to enter or modify, via the user interface means, records in any of the database tables.

Facebook

Robert Fine Photo 23

Robert Fine

view source
Robert Fine Photo 24

Robert Fine

view source
Robert Fine Photo 25

Robert Fine

view source
Robert Fine Photo 26

Robert Fine

view source
Robert Fine Photo 27

Fine Robert

view source
Robert Fine Photo 28

Jerome Fine Robert

view source
Robert Fine Photo 29

Robert Fine

view source
Robert Fine Photo 30

Robert Fine

view source

Myspace

Robert Fine Photo 31

Robert Fine

view source
Locality:
Peggs, Oklahoma
Gender:
Male
Birthday:
1938
Robert Fine Photo 32

Bobby Fine

view source
Locality:
ATLANTA, GEORGIA
Gender:
Male
Birthday:
1950
Robert Fine Photo 33

Robert Fine

view source
Locality:
Peggs, Oklahoma
Gender:
Male
Birthday:
1938
Robert Fine Photo 34

Robert Fine

view source
Locality:
East Cobb, Georgia
Gender:
Male
Birthday:
1914
Robert Fine Photo 35

Robert Fine

view source
Locality:
GURNEE, Illinois
Gender:
Male

Youtube

Robert Fine - How Little We Know

Robert Fine and the swinging Dreamland band - Cancer Relay for the Cur...

  • Duration:
    2m 40s

Robert Grace - Fake Fine (Official Video)

The reaction to my new single 'Fake Fine' has been amazing and now I a...

  • Duration:
    3m 19s

Robert Palmer - Fine Time - 1975 (HQ Audio)

Vinyl LP rip from Robert Palmer's 1975 album "Pressure Drop". It's har...

  • Duration:
    5m 50s

Robert Fine - Be Careful its My Heart

Robert Fine and the swinging Dreamland band - Cancer Relay for the Cur...

  • Duration:
    1m 54s

Fine Time

Provided to YouTube by Universal Music Group Fine Time Robert Palmer ...

  • Duration:
    5m 52s

Robert Cray - 'Fine Yesterday' Unplugged | Cl...

----------------... Robert Cray performs 'Fine Yesterday' unplugged f...

  • Duration:
    4m 28s

Flickr

Classmates

Robert Fine Photo 44

Robert Girard (Fine)

view source
Schools:
St. Cyril - St. Clara School Chicago IL 1953-1955, John P. Altgeld Elementary School Chicago IL 1957-1958, Van Vlissingen Elementary School Chicago IL 1958-1959
Community:
William Bill, Darryl Simpson, Gerald Braasch, Gerry Armin
Biography:
Life The last school I attended was Fenger high, however I was still going by the l...
Robert Fine Photo 45

Robert Fine

view source
Schools:
Central High School Bridgeport CT 1972-1976
Community:
Carol Tilton, Margarita Misinonile
Robert Fine Photo 46

Robert Fine

view source
Schools:
Southwest High School South Miami FL 1959-1963
Community:
Clorinda Wise, Ric Bosch, Kathy Sherry
Robert Fine Photo 47

Robert Fine

view source
Schools:
Glover Elementary School Marblehead MA 1940-1947
Community:
Lesley Smith, Edward Googe, Gladys Kriegler
Robert Fine Photo 48

Robert Fine

view source
Schools:
Lane Technical High School Chicago IL 1960-1964
Community:
Lisa Wozniak, Marc Guerrero, Dale Mandel, William Burns, Joel Gimpel
Robert Fine Photo 49

Robert Fine

view source
Schools:
La Fayette Elementary School Chicago IL 1957-1961
Community:
Chester Stump, Joy Thornborough, Susan Besaw, Barbara Wasilewski, Sandra Torres
Robert Fine Photo 50

Robert Fine

view source
Schools:
Oriole Park Public School Toronto Morocco 1952-1960
Community:
Donna Lerch, Douglas Bailey, David Growe, Don Renwicke, Sue Dingle
Robert Fine Photo 51

Robert B. Fine

view source
Schools:
Miller Great Neck North High School Great Neck NY 1969-1973
Community:
Lisa Klahr, Andrea Kaplan

Plaxo

Robert Fine Photo 52

Robert Fine

view source
Executive VP at 2CFOs LLC

Googleplus

Robert Fine Photo 53

Robert Fine

Lived:
Staten Island, NY
Brooklyn, NY
Laurelton, Queens, NY
Culver City, CA
Wilmington, De
Work:
Coldwell Banker Di Tommaso Realty - Real Estate
VIP
Education:
Sheepshead Bay HS, Brooklyn College
Relationship:
Married
Tagline:
Intelligent Caring
Bragging Rights:
I'm still standing after all these years! Married 34 years. Two wonderful kids and my first grandkid almost here.
Robert Fine Photo 54

Robert Fine

About:
Christian; volunteer firefighter; weather geek; musician?; always looking for people to meet and things to learn.
Bragging Rights:
I'm in the security profession. I'm a little less Batman and a little more Captain America (pre-enhancement).
Robert Fine Photo 55

Robert Fine

Robert Fine Photo 56

Robert Fine

Robert Fine Photo 57

Robert Fine

Robert Fine Photo 58

Robert Fine

Robert Fine Photo 59

Robert Fine

Robert Fine Photo 60

Robert Fine


Get Report for Robert A Fine from Sarasota, FL, age ~81
Control profile